HERC3 Peptide - N-terminal region
HERC3 Peptide - N-terminal region
Product Specifications
UniProt
Q15034
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HERC3 Rabbit Polyclonal Antibody (orb578743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055421
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-09813 0.1 mg
CRYBA2 Overexpression Lysate (Native) - (Dry Ice)
Sign In for Pricing
View Details 
E28G2086 100 µL
Retinoblastoma (Phospho S807) (4H3) Rabbit Monoclonal Antibody
Sign In for Pricing
View Details