Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC3 Peptide - N-terminal region

HERC3 Peptide - N-terminal region

Product Specifications

UniProt

Q15034

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HERC3 Rabbit Polyclonal Antibody (orb578743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055421

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-193b-3p miRNA Mimic
orb1873526-01 5 nmol

Rno-miR-193b-3p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-193b-3p miRNA Mimic
orb1873526-02 10 nmol

Rno-miR-193b-3p miRNA Mimic

Sign In for Pricing
View Details
TACC3 Antibody, mAb, Rabbit
A02539-50 50 µL

TACC3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS7115930-01 0.05 mg

SLC25A31 Antibody

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS7115930-02 0.1 mg

SLC25A31 Antibody

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS7115930-03 5x 0.1 mg

SLC25A31 Antibody

Sign In for Pricing
View Details