Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT122 Peptide - middle region

IFT122 Peptide - middle region

Product Specifications

Product Name Alternative

CED, SPG, CED1, WDR10, WDR10p, WDR140

UniProt

Q9HBG6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFT122 Rabbit Polyclonal Antibody (orb582239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_443715

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse St6galnac1 shRNA (UAS) - Lentiviral mouse St6galnac1 shRNA (UAS, iRFP) plasmid
GTR15264808 1 Vial

Lentiviral mouse St6galnac1 shRNA (UAS) - Lentiviral mouse St6galnac1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
2-Amino-1,3-thiazole-4,5-dicarboxamide
ZAA04457-01 50 mg

2-Amino-1,3-thiazole-4,5-dicarboxamide

Sign In for Pricing
View Details
2-Amino-1,3-thiazole-4,5-dicarboxamide
ZAA04457-02 0.5 g

2-Amino-1,3-thiazole-4,5-dicarboxamide

Sign In for Pricing
View Details
Slc9a3 3'UTR GFP Stable Cell Line
TU169230 1.0 mL

Slc9a3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf18 (wtf18)
orb2909798-01 20 µg

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf18 (wtf18)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf18 (wtf18)
orb2909798-02 100 µg

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf18 (wtf18)

Sign In for Pricing
View Details