Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA2 Peptide - middle region

GBA2 Peptide - middle region

Product Specifications

Product Name Alternative

AD035, SPG46, NLGase

UniProt

Q9HCG7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBA2 Rabbit Polyclonal Antibody (orb583585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065995

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pECMV-3*Flag-Survium Plasmid
PVT10299 2 µg

pECMV-3*Flag-Survium Plasmid

Sign In for Pricing
View Details
CD40
592462 200 µg

CD40

Sign In for Pricing
View Details
Klra3 Hamster Monoclonal Antibody [Clone ID: 14B11]
AM08064FC-N 500 µg

Klra3 Hamster Monoclonal Antibody [Clone ID: 14B11]

Sign In for Pricing
View Details
Methyl 3-Amino-3- (2-chloro-6-fluorophenyl) propanoate
PC109433-01 250 mg

Methyl 3-Amino-3- (2-chloro-6-fluorophenyl) propanoate

Sign In for Pricing
View Details
Methyl 3-Amino-3- (2-chloro-6-fluorophenyl) propanoate
PC109433-02 500 mg

Methyl 3-Amino-3- (2-chloro-6-fluorophenyl) propanoate

Sign In for Pricing
View Details
Methyl 3-Amino-3- (2-chloro-6-fluorophenyl) propanoate
PC109433-03 1 g

Methyl 3-Amino-3- (2-chloro-6-fluorophenyl) propanoate

Sign In for Pricing
View Details