Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA2 Peptide - middle region

GBA2 Peptide - middle region

Product Specifications

Product Name Alternative

AD035, SPG46, NLGase

UniProt

Q9HCG7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBA2 Rabbit Polyclonal Antibody (orb583585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065995

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2) (MaxLight 405) discontinued
123109-ML405 100 µL

AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mtrr (NM_001039003) Rat Tagged ORF Clone Lentiviral Particle
RR206318L4V 200 µL

Mtrr (NM_001039003) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse TGF-beta RII (NP_033397) VersaClone cDNA
RDC1336 10 µg

Mouse TGF-beta RII (NP_033397) VersaClone cDNA

Sign In for Pricing
View Details
Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)
orb1653200-01 20 µg

Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)

Sign In for Pricing
View Details
Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)
orb1653200-02 100 µg

Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)

Sign In for Pricing
View Details
Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)
orb1653200-03 1 mg

Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)

Sign In for Pricing
View Details