Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO5 Peptide - N-terminal region

ANO5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GDD1, LGMD2L, TMEM16E

UniProt

Q75V66

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO5 Rabbit Polyclonal Antibody (orb586528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_998764

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM119A (METTL21A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D11]
TA811541BM 100 µL

FAM119A (METTL21A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D11]

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF740 conjugate, 0.1mg/mL
BNC741807-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMC10 Rabbit Polyclonal Antibody
ER1902-08 100 µL

EMC10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IMMT Antibody
KC-547-01 50 μL

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
KC-547-02 100 µL

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
KC-547-03 1 mL

IMMT Antibody

Sign In for Pricing
View Details