Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO5 Peptide - N-terminal region

ANO5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GDD1, LGMD2L, TMEM16E

UniProt

Q75V66

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO5 Rabbit Polyclonal Antibody (orb586528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_998764

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Met Wang Resin
H0751501318.25G 25 g

Fmoc-Met Wang Resin

Sign In for Pricing
View Details
SAR1B (NM_016103) Human Over-expression Lysate
LY402500 100 µg

SAR1B (NM_016103) Human Over-expression Lysate

Sign In for Pricing
View Details
BRAF Antibody
KC-2310-01 50 μL

BRAF Antibody

Sign In for Pricing
View Details
BRAF Antibody
KC-2310-02 100 µL

BRAF Antibody

Sign In for Pricing
View Details
BRAF Antibody
KC-2310-03 1 mL

BRAF Antibody

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), 0.2mg/mL
BNUB2409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), 0.2mg/mL

Sign In for Pricing
View Details