Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC3 Peptide - N-terminal region

TMC3 Peptide - N-terminal region

Product Specifications

UniProt

Q7Z5M5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMC3 Rabbit Polyclonal Antibody (orb635624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001074001

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGHLERPAYVPRKPRSRNFQYPQPPLKPRGKPRFEPSLTESDSVSAASSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human DSG3 (Forerunner patent Anti-DSG3 Biosimilar)
BIO0388SM-1mg 1 mg

Anti-human DSG3 (Forerunner patent Anti-DSG3 Biosimilar)

Sign In for Pricing
View Details
Phytane
462580-01 25 mg

Phytane

Sign In for Pricing
View Details
Phytane
462580-02 100 mg

Phytane

Sign In for Pricing
View Details
UCP3 Rabbit Polyclonal Antibody
AF8295 50 µL

UCP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PREB Rabbit mAb
MBS9469329-01 0.05 mL

PREB Rabbit mAb

Sign In for Pricing
View Details
PREB Rabbit mAb
MBS9469329-02 0.1 mL

PREB Rabbit mAb

Sign In for Pricing
View Details