FAM40A Peptide - C-terminal region
FAM40A Peptide - C-terminal region
Product Specifications
Product Name Alternative
FAM40A, FAR11A
UniProt
Q5VSL9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM40A Rabbit Polyclonal Antibody (orb635625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_149079
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470525-500 1x 500 µL
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880158-100 1x 100 µL
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details