Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC5 Peptide - C-terminal region

SMC5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SMC5L1

UniProt

Q8IY18

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055925.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zc3h6 Mouse Gene Knockout Kit (CRISPR)
KN519646 1 Kit

Zc3h6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EB2 (MAPRE2) (N-term) Rabbit Polyclonal Antibody
AP52606PU-N 400 µL

EB2 (MAPRE2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (121-3), 0.2mg/mL
BNUB0945-500 1x 500 µL

Double Stranded DNA (dsDNA) (121-3), 0.2mg/mL

Sign In for Pricing
View Details
GUCY1A2 (NM_000855) Human Over-expression Lysate
LC424486 20 µg

GUCY1A2 (NM_000855) Human Over-expression Lysate

Sign In for Pricing
View Details
Vinmegallate
TRC-V314800-5MG 5 mg

Vinmegallate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS647374 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details