Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC5 Peptide - C-terminal region

SMC5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SMC5L1

UniProt

Q8IY18

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055925.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® S RAM
S30023.25G 25 g

TentaGel® S RAM

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), CF488A conjugate, 0.1mg/mL
BNC881621-500 1x 500 µL

Endoglin / CD105 (ENG/1621), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4E-BP1 (Ab-36) Antibody
8B0884-AAT 50 µg

4E-BP1 (Ab-36) Antibody

Sign In for Pricing
View Details
Human CRELD1 activation kit by CRISPRa
GA112289 1 Kit

Human CRELD1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Chloro-1-(4-chlorophenyl)ethanone
TRC-C368618-500MG 500 mg

2-Chloro-1-(4-chlorophenyl)ethanone

Sign In for Pricing
View Details
HLA-DRB5 Rabbit Polyclonal Antibody
TA370098 100 µL

HLA-DRB5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details