Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP133 Peptide - middle region

NUP133 Peptide - middle region

Product Specifications

Product Name Alternative

GAMOS8, NPHS18, hNUP133

UniProt

Q8WUM0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060700.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFRP Lentiviral Activation Particles (h)
sc-406767-LAC 200 µL

RFRP Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)
MBS2102189-01 5x 96 Tests

Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)
MBS2102189-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)
MBS2102189-03 10x 96 Tests

Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)
MBS2102189-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Cathepsin C (CTSC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
4-Aminophenyl 1-Thio-beta-D-glucopyranoside
TRC-A626995-100MG 100 mg

4-Aminophenyl 1-Thio-beta-D-glucopyranoside

Sign In for Pricing
View Details