What is the catalog number for NUP133 Peptide - middle region?

The catalog number for NUP133 Peptide - middle region is orb1997459.

What sizes are available for NUP133 Peptide - middle region?

NUP133 Peptide - middle region is available in the following size(s): 100 µg.

Is NUP133 Peptide - middle region in stock?

NUP133 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NUP133 Peptide - middle region

Product Specifications

Product Name Alternative

GAMOS8, NPHS18, hNUP133

UniProt

Q8WUM0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060700.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY-RS20038 1 Set

Il1r1 Mouse Pre-designed siRNA Set A

Sign In for Pricing

View Details

MBS242389-01 0.05 mL

Rabbit Polyclonal to Human Lamin C

Sign In for Pricing

View Details

MBS242389-02 5x 0.05 mL

Rabbit Polyclonal to Human Lamin C

Sign In for Pricing

View Details

E45M42825M5 20 µg

Cldn19 (NM_153105) Mouse Recombinant Protein

Sign In for Pricing

View Details

FP-046 100 µL - 10 Tests

C-MET/CEP7

Sign In for Pricing

View Details

A00284-1-Dylight594 100 µg

Anti-NF-kB p65/RELA Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing

View Details