Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A10, Mouse (HEK293, His)

Serpin A10 Protein, an inhibitor, regulates by inhibiting the activity of coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. It also shows inhibitory effects on factor XIa even without cofactors, highlighting its versatility in modulating key components of the coagulation cascade. Serpin A10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Serpin A10 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a10-protein-mouse-hek293-his.html

Purity

97.00

Smiles

FNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSGTLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL

Molecular Formula

217847 (Gene_ID) Q8R121-1 (F22-L448) (Accession)

Molecular Weight

Approximately 75-95 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (Azide free) (HRP)
MBS6297981-01 0.2 mL

FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (Azide free) (HRP)

Sign In for Pricing
View Details
FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (Azide free) (HRP)
MBS6297981-02 5x 0.2 mL

FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (Azide free) (HRP)

Sign In for Pricing
View Details
GCM2 HDR Plasmid (h)
sc-404318-HDR 20 µg

GCM2 HDR Plasmid (h)

Sign In for Pricing
View Details
NKX23 Polyclonal Antibody
ABP59475-01 30 µL

NKX23 Polyclonal Antibody

Sign In for Pricing
View Details
NKX23 Polyclonal Antibody
ABP59475-02 100 µL

NKX23 Polyclonal Antibody

Sign In for Pricing
View Details
NKX23 Polyclonal Antibody
ABP59475-03 200 µL

NKX23 Polyclonal Antibody

Sign In for Pricing
View Details