Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

This product is a synthetic derivative of the Exendin-4 peptide, with the sequence FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS. It is utilized in research applications, including in vitro and in vivo studies, to investigate mechanisms related to glucose metabolism and GLP-1 receptor signaling.

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Molecular Weight

3692.15

Storage Conditions

-20°C

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF405S conjugate, 0.1mg/mL
BNC041387-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details