FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This product is a synthetic derivative of the Exendin-4 peptide, with the sequence FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS. It is utilized in research applications, including in vitro and in vivo studies, to investigate mechanisms related to glucose metabolism and GLP-1 receptor signaling.
Product Specifications
Field of Research
Pharmacology & Drug Discovery
Molecular Weight
3692.15
Storage Conditions
-20°C
Notes
For research use only.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog