GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This product is a synthetic derivative of the Exendin-4 peptide, with the sequence GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS. It is a research tool used in vitro and in vivo to study GLP-1 receptor signaling, metabolic pathways, and potential therapeutic applications for diabetes and obesity.
Product Specifications
Field of Research
Pharmacology & Drug Discovery
Molecular Weight
3850.31
Storage Conditions
-20°C
Notes
For research use only.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog