Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

This product is a synthetic derivative of the Exendin-4 peptide, with the sequence GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS. It is a research tool used in vitro and in vivo to study GLP-1 receptor signaling, metabolic pathways, and potential therapeutic applications for diabetes and obesity.

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Molecular Weight

3850.31

Storage Conditions

-20°C

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog