Cagrilintide acetate
Cagrilintide acetate is the salt form of a long-acting amylin analog. It is used in research for type 2 diabetes and obesity, functioning as an agonist at the AMY3 and CTR receptors to suppress appetite. Its applications include in vitro receptor studies and in vivo models investigating metabolic regulation and weight loss.
Product Specifications
Field of Research
Neuroscience, Pharmacology & Drug Discovery
Purity
99.88% (May vary between batches)
Solubility
DMSO: 80 mg/mL (17.9 mM), Sonication is recommended. H2O: 40 mg/mL (8.95 mM), Sonication is recommended.
Molecular Weight
4469.06
Storage Conditions
-20°C
Notes
For research use only.
AA Sequence
{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS335020-01 0.2 mg
Mouse Anti-Human CD8 Monoclonal Antibody,Azide Free Clone B-Z31
Sign In for Pricing
View Details MBS335020-02 0.5 mg
Mouse Anti-Human CD8 Monoclonal Antibody,Azide Free Clone B-Z31
Sign In for Pricing
View Details MBS335020-03 5x 0.5 mg
Mouse Anti-Human CD8 Monoclonal Antibody,Azide Free Clone B-Z31
Sign In for Pricing
View Details 
K1513905 3x 1.0 µg
OR4S2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details HP227600 200 Reactions
Netrin G1 (NTNG1) Human qPCR Primer Pair (NM_014917)
Sign In for Pricing
View Details