Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cagrilintide acetate

Cagrilintide acetate is the salt form of a long-acting amylin analog. It is used in research for type 2 diabetes and obesity, functioning as an agonist at the AMY3 and CTR receptors to suppress appetite. Its applications include in vitro receptor studies and in vivo models investigating metabolic regulation and weight loss.

Product Specifications

Field of Research

Neuroscience, Pharmacology & Drug Discovery

Purity

99.88% (May vary between batches)

Solubility

DMSO: 80 mg/mL (17.9 mM), Sonication is recommended. H2O: 40 mg/mL (8.95 mM), Sonication is recommended.

Molecular Weight

4469.06

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PERP TP53 apoptosis effector (PERP) polyclonal antibody
ABP-PAB-10284 100 ug

PERP TP53 apoptosis effector (PERP) polyclonal antibody

Sign In for Pricing
View Details
TTLL8 Antibody, Biotin conjugated
A37675-100UG 100 µg

TTLL8 Antibody, Biotin conjugated

Sign In for Pricing
View Details
N-[4- (1-Benzoyl-4-piperidinyl) butyl]-3- (3-pyridinyl) -2-propenamide Hydrochloride
457757 1 mg

N-[4- (1-Benzoyl-4-piperidinyl) butyl]-3- (3-pyridinyl) -2-propenamide Hydrochloride

Sign In for Pricing
View Details
Presenilin 1 Polyclonal Antibody, RBITC Conjugated
bs-0024R-RBITC-01 20 µL

Presenilin 1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Presenilin 1 Polyclonal Antibody, RBITC Conjugated
bs-0024R-RBITC-02 100 µL

Presenilin 1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human KCNK17 knockout cell line
ABC-KH7712 1 Vial

Human KCNK17 knockout cell line

Sign In for Pricing
View Details