Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived
Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived
Product Specifications
Field of Research
Immunology & Inflammation
Endotoxin
Less than 0.1 EU/ugof rHuCD24-Fc as determined by LAL method.
Purity
> 95 % by SDS-PAGE analyses.
Bioactivity
Testing in progress.
Form
Lyophilized from a 0.2 μm filtered concentrated solution in PBS.
Molecular Weight
The protein has a calculated MW of 30.4 kDa, containing 276 amino acids. The protein migrates as 40-50 kDa in SDS-PAGE under reducing condition due to glycosylation.
Storage Conditions
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes
For research use only.
AA Sequence
AGMGMSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGIEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog