Recombinant Human CD59
Recombinant Human CD59
Product Specifications
Field of Research
Immunology & Inflammation
Endotoxin
Less than 0.1 EU/ugof rHuCD59 as determined by LAL method.
Purity
> 97 % by SDS-PAGE analyses.
Bioactivity
Testing in progress.
Form
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.
Molecular Weight
Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
Storage Conditions
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes
For research use only.
AA Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6325082-01 0.2 mL
NFKBID, NT (NFKBID, IKBNS, NF-kappa-B inhibitor delta, I-kappa-B-delta, IkappaBNS, T-cell activation NFKB-like protein, TA-NFKBH) (APC)
Sign In for Pricing
View Details MBS6325082-02 5x 0.2 mL
NFKBID, NT (NFKBID, IKBNS, NF-kappa-B inhibitor delta, I-kappa-B-delta, IkappaBNS, T-cell activation NFKB-like protein, TA-NFKBH) (APC)
Sign In for Pricing
View Details N2300-60A-ML650 100 µL
NFIL3 (E4 Promoter Binding Protein 4, E4BP4, E4BP4 Protein, Interleukin 3 Binding Protein 1, IL3BP1, Interleukin 3 Promoter Transcriptional Activator, NFIL3A, Nuclear Factor Interleukin 3 Regulated, Transcriptional Activator NF-IL3A) (MaxLight 650) discontinued
Sign In for Pricing
View Details