Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD59

Recombinant Human CD59

Product Specifications

Field of Research

Immunology & Inflammation

Endotoxin

Less than 0.1 EU/ugof rHuCD59 as determined by LAL method.

Purity

> 97 % by SDS-PAGE analyses.

Bioactivity

Testing in progress.

Form

Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.

Molecular Weight

Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.

Storage Conditions

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Notes

For research use only.

AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STAU1
MBS7613015-01 0.05 mg

Recombinant Human STAU1

Sign In for Pricing
View Details
Recombinant Human STAU1
MBS7613015-02 0.2 mg

Recombinant Human STAU1

Sign In for Pricing
View Details
Recombinant Human STAU1
MBS7613015-03 1 mg

Recombinant Human STAU1

Sign In for Pricing
View Details
Recombinant Human STAU1
MBS7613015-04 5x 1 mg

Recombinant Human STAU1

Sign In for Pricing
View Details
[D-Ala2, DPro4, Tyr5]-beta-Casomorphin (1-5), amide
VAC-00823-01 5 mg

[D-Ala2, DPro4, Tyr5]-beta-Casomorphin (1-5), amide

Sign In for Pricing
View Details
[D-Ala2, DPro4, Tyr5]-beta-Casomorphin (1-5), amide
VAC-00823-02 10 mg

[D-Ala2, DPro4, Tyr5]-beta-Casomorphin (1-5), amide

Sign In for Pricing
View Details