Recombinant Human CD59
Recombinant Human CD59
Product Specifications
Field of Research
Immunology & Inflammation
Endotoxin
Less than 0.1 EU/ugof rHuCD59 as determined by LAL method.
Purity
> 97 % by SDS-PAGE analyses.
Bioactivity
Testing in progress.
Form
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.
Molecular Weight
Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
Storage Conditions
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes
For research use only.
AA Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
