PEP1

PEP1 is a bioactive peptide that binds to POPC supported lipid bilayers at low concentrations and induces their lysis at higher concentrations. This makes it a useful tool for studying membrane interactions, peptide-induced bilayer disruption, and mechanisms of lytic activity in both in vitro biophysical and cell-based assays.

Product Specifications

Field of Research

Metabolism Research

Molecular Weight

3805.27

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2; Sequence Short: SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2