PEP1
PEP1 is a bioactive peptide that binds to POPC supported lipid bilayers at low concentrations and induces their lysis at higher concentrations. This makes it a useful tool for studying membrane interactions, peptide-induced bilayer disruption, and mechanisms of lytic activity in both in vitro biophysical and cell-based assays.
Product Specifications
Field of Research
Metabolism Research
Molecular Weight
3805.27
Storage Conditions
-20°C
Notes
For research use only.
AA Sequence
Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2; Sequence Short: SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
SYP-H0123-01 48 Well
Human AGER(Total Advanced Glycosylation End Product Specific Receptor) ELISA Kit
Sign In for Pricing
View Details 
SYP-H0123-02 96 Well
Human AGER(Total Advanced Glycosylation End Product Specific Receptor) ELISA Kit
Sign In for Pricing
View Details