Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-13/GDF-6, Mouse

The BMP-13/GDF-6 protein is a multifunctional growth factor that plays a critical role in retinal development, control of apoptosis, and dorsoventral positional information. It is critical for bone and joint development in various anatomical regions, influencing species-specific skeletal changes and contributing to the evolution of unique anatomical features. BMP-13/GDF-6 Protein, Mouse is the recombinant mouse-derived BMP-13/GDF-6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

BMP-13/GDF-6 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-13-gdf-6-protein-mouse.html

Purity

95.0

Smiles

TAFASRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

Molecular Formula

242316 (Gene_ID) P43028 (T335-R454) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAC8 Polyclonal Antibody
orb1419585 100 µL

PLAC8 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Glycine ELISA kit
GTR10405697 96 Well

Rabbit Glycine ELISA kit

Sign In for Pricing
View Details
Phospho-ERBB4 (Tyr984) Antibody Blocking Peptide
orb1505382 500 µg

Phospho-ERBB4 (Tyr984) Antibody Blocking Peptide

Sign In for Pricing
View Details
SEC61B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2114305 3x 1.0 µg

SEC61B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CK10 Rabbit Polyclonal Antibody (HRP)
orb1597466 100 µL

CK10 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FAF1 Polyclonal Antibody
E20-71658 100 µg

FAF1 Polyclonal Antibody

Sign In for Pricing
View Details