Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor - alpha

Recombinant Human Transforming Growth Factor - alpha

Product Specifications

Source

Escherichia coli

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 0.1 EU/ug of rHuTGF-α as determined by LAL method.

Purity

>95% by SDS-PAGE analyses.

Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-0.4 ng/ml.

Form

Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA.

Molecular Weight

Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.

Storage Conditions

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Notes

For research use only.

AA Sequence

MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceacam2 sgRNA CRISPR Lentivector set (Mouse)
K3190201 3x 1.0 µg

Ceacam2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-SUZ12 Antibody
CQA7971-01 30 µL

Anti-SUZ12 Antibody

Sign In for Pricing
View Details
Anti-SUZ12 Antibody
CQA7971-02 50 μL

Anti-SUZ12 Antibody

Sign In for Pricing
View Details
Anti-SUZ12 Antibody
CQA7971-03 100 µL

Anti-SUZ12 Antibody

Sign In for Pricing
View Details
Anti-SUZ12 Antibody
CQA7971-04 200 µL

Anti-SUZ12 Antibody

Sign In for Pricing
View Details
LAMP-2 (H4B4) Alexa Fluor® 488
sc-18822 AF488 200 µg/mL

LAMP-2 (H4B4) Alexa Fluor® 488

Sign In for Pricing
View Details