Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor - alpha

Recombinant Human Transforming Growth Factor - alpha

Product Specifications

Source

Escherichia coli

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 0.1 EU/ug of rHuTGF-α as determined by LAL method.

Purity

>95% by SDS-PAGE analyses.

Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-0.4 ng/ml.

Form

Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA.

Molecular Weight

Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.

Storage Conditions

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Notes

For research use only.

AA Sequence

MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ccna1 Antibody (Center)
E45R31819G-1 100 µL

Mouse Ccna1 Antibody (Center)

Sign In for Pricing
View Details
Human SCP2D1-AS1 qPCR Primer Pair
QH82757S 200 Tests

Human SCP2D1-AS1 qPCR Primer Pair

Sign In for Pricing
View Details
Pig TGFb1 (Transforming Growth Factor Beta 1) ELISA Kit
EK245178 96 Well

Pig TGFb1 (Transforming Growth Factor Beta 1) ELISA Kit

Sign In for Pricing
View Details
TGIF (TGIF1) (NM_173210) Human Tagged Lenti ORF Clone
RC223830L4 10 µg

TGIF (TGIF1) (NM_173210) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Pinus thunbergii Chlorophyll a-b binding protein type I, chloroplastic
orb2917673-01 20 µg

Recombinant Pinus thunbergii Chlorophyll a-b binding protein type I, chloroplastic

Sign In for Pricing
View Details
Recombinant Pinus thunbergii Chlorophyll a-b binding protein type I, chloroplastic
orb2917673-02 100 µg

Recombinant Pinus thunbergii Chlorophyll a-b binding protein type I, chloroplastic

Sign In for Pricing
View Details