Recombinant Human Transforming Growth Factor - alpha
Recombinant Human Transforming Growth Factor - alpha
Product Specifications
Source
Escherichia coli
Field of Research
Stem Cell & Developmental Biology
Endotoxin
Less than 0.1 EU/ug of rHuTGF-α as determined by LAL method.
Purity
>95% by SDS-PAGE analyses.
Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-0.4 ng/ml.
Form
Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA.
Molecular Weight
Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
Storage Conditions
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes
For research use only.
AA Sequence
MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2147046-01 0.1 mL
APC-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 3 (IGFBP3)
Sign In for Pricing
View Details 
MBS2147046-02 0.2 mL
APC-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 3 (IGFBP3)
Sign In for Pricing
View Details MBS2147046-03 0.5 mL
APC-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 3 (IGFBP3)
Sign In for Pricing
View Details 
MBS2147046-04 1 mL
APC-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 3 (IGFBP3)
Sign In for Pricing
View Details MBS2147046-05 5 mL
APC-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 3 (IGFBP3)
Sign In for Pricing
View Details