Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD81 antigen (CD81), partial (Active)

This Recombinant Human CD81 antigen (CD81), partial (Active) spans the amino acid sequence from region 113-201aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TAPA1; TSPAN28

UniProt

P60033

Expression Region

113-201aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD81 at 2 μg/mL can bind Anti-CD81 recombinant antibody, the EC50 is 4.166-5.578 ng/mL.

Form

Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NEK4 Antibody [FITC]
NBP1-42686F 0.1 mL

Rabbit Polyclonal NEK4 Antibody [FITC]

Sign In for Pricing
View Details
Evi2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6389706 1.0 µg DNA

Evi2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Psg21 Mouse shRNA Lentiviral Particle (Locus ID 72242)
TL509822V 500 µL Each

Psg21 Mouse shRNA Lentiviral Particle (Locus ID 72242)

Sign In for Pricing
View Details
FBXO47 (N-term) Rabbit Polyclonal Antibody
AP51633PU-N 400 µL

FBXO47 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Cytochrome P450 26A1 ELISA Kit
MBS096174 Inquire

Rabbit Cytochrome P450 26A1 ELISA Kit

Sign In for Pricing
View Details
C2ORF25 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9808R-BF488 100 µL

C2ORF25 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details