Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage lambda Antiholin (S), partial

This Recombinant Enterobacteria phage lambda Holin (S), partial spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Lysis inhibitor S-107)

UniProt

P03705

Expression Region

1-37aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Escherichia phage lambda (Bacteriophage lambda)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-1 receptor type 1
MBS7042901-01 0.02 mg

Interleukin-1 receptor type 1

Sign In for Pricing
View Details
Interleukin-1 receptor type 1
MBS7042901-02 0.1 mg

Interleukin-1 receptor type 1

Sign In for Pricing
View Details
Interleukin-1 receptor type 1
MBS7042901-03 5x 0.1 mg

Interleukin-1 receptor type 1

Sign In for Pricing
View Details
AdmiRa-hsa-mir-4468 Virus
mh1249 250 µL

AdmiRa-hsa-mir-4468 Virus

Sign In for Pricing
View Details
FATE1 Blocking peptide
orb1442748 500 µg

FATE1 Blocking peptide

Sign In for Pricing
View Details
Lentiviral mouse Sfpq shRNA (UAS) - Lentiviral mouse Sfpq shRNA (UAS, GFP) plasmid
GTR15238414 1 Vial

Lentiviral mouse Sfpq shRNA (UAS) - Lentiviral mouse Sfpq shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details