Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage lambda Antiholin (S), partial

This Recombinant Enterobacteria phage lambda Holin (S), partial spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Lysis inhibitor S-107)

UniProt

P03705

Expression Region

1-37aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Escherichia phage lambda (Bacteriophage lambda)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PTPDC1 sgRNA gene knockout kit - Lentiviral human PTPDC1 sgRNA gene knockout kit (plasmid)
GTR15386534 1 Vial

Lentiviral human PTPDC1 sgRNA gene knockout kit - Lentiviral human PTPDC1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human GP4/CD36 (Platelet Membrane Glycoprotein IV) ELISA Kit
RE1585H-01 48 Tests

Human GP4/CD36 (Platelet Membrane Glycoprotein IV) ELISA Kit

Sign In for Pricing
View Details
Human GP4/CD36 (Platelet Membrane Glycoprotein IV) ELISA Kit
RE1585H-02 96 Tests

Human GP4/CD36 (Platelet Membrane Glycoprotein IV) ELISA Kit

Sign In for Pricing
View Details
CD172a/SIRPA Mouse Monoclonal Antibody (FITC)
orb2973733-01 50 Tests

CD172a/SIRPA Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CD172a/SIRPA Mouse Monoclonal Antibody (FITC)
orb2973733-02 100 Tests

CD172a/SIRPA Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Matrix Metalloproteinase 3 (MMP3)
MBS2119197-01 0.1 mL

APC-Linked Monoclonal Antibody to Matrix Metalloproteinase 3 (MMP3)

Sign In for Pricing
View Details