Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial

This Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial spans the amino acid sequence from region 47-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Mannoprotein of 65 kDa) (Soluble cell wall protein 10)

UniProt

Q59XX2

Expression Region

47-125aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGNGDQTTTFAAPSVAAESSVSVSVNTEPPQNHPTTTQDVASASTYPSSTDGSAASSSAAASSSSQAGSEPSGGVGSGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse BMPR1A Protein
orb2994510-01 10 µg

Recombinant Mouse BMPR1A Protein

Sign In for Pricing
View Details
Recombinant Mouse BMPR1A Protein
orb2994510-02 50 µg

Recombinant Mouse BMPR1A Protein

Sign In for Pricing
View Details
Recombinant Mouse BMPR1A Protein
orb2994510-03 500 µg

Recombinant Mouse BMPR1A Protein

Sign In for Pricing
View Details
Recombinant Mouse BMPR1A Protein
orb2994510-04 1 mg

Recombinant Mouse BMPR1A Protein

Sign In for Pricing
View Details
VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein
TP305337L 1 mg

VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2148175-01 0.1 mL

APC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details