Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dickkopf-related protein 4 (DKK4)

This Recombinant Human Dickkopf-related protein 4 (DKK4) spans the amino acid sequence from region 19-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Dickkopf-4) (Dkk-4) (hDkk-4)

UniProt

Q9UBT3

Expression Region

19-224aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYPD4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
27840064 1.0 µg DNA

LYPD4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TBS High Salt for Western Blot Washing 10X
10530026-1 1 L

TBS High Salt for Western Blot Washing 10X

Sign In for Pricing
View Details
Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit
MBS060476-01 48 Well

Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit
MBS060476-02 96 Well

Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit
MBS060476-03 5x 96 Well

Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit
MBS060476-04 10x 96 Well

Sheep Transcription Factor Binding To IGHM Enhancer 3 ELISA Kit

Sign In for Pricing
View Details