Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Wnt-3a (Wnt3a), partial

This Recombinant Mouse Protein Wnt-3a (Wnt3a), partial spans the amino acid sequence from region 130-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P27467

Expression Region

130-250aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clathrin, Heavy Chain (CHC/1432), CF594 conjugate, 0.1mg/mL
BNC941432-500 1x 500 µL

Clathrin, Heavy Chain (CHC/1432), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase IV (LIG4) Human Knockdown Lysate
LY300226 100 µg

DNA Ligase IV (LIG4) Human Knockdown Lysate

Sign In for Pricing
View Details
Human SCAF1 activation kit by CRISPRa
GA111787 1 Kit

Human SCAF1 activation kit by CRISPRa

Sign In for Pricing
View Details
TRPV4 Polyclonal Antibody
E-AB-14424-01 20 µL

TRPV4 Polyclonal Antibody

Sign In for Pricing
View Details
TRPV4 Polyclonal Antibody
E-AB-14424-02 60 µL

TRPV4 Polyclonal Antibody

Sign In for Pricing
View Details
TRPV4 Polyclonal Antibody
E-AB-14424-03 120 µL

TRPV4 Polyclonal Antibody

Sign In for Pricing
View Details