Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein L (gL)

This Recombinant Human herpesvirus 2 Envelope glycoprotein L (gL) spans the amino acid sequence from region 17-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(gL)

UniProt

P28278

Expression Region

17-224aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWGGSQATEYVLRSVIAKEVGDILRVPCMRTPADDVSWRYEAPSVIDYARIDGIFLRYHCPGLDTFLWDRHAQRAYLVNPFLFAAGFLEDLSHSVFPADTQETTTRRALYKEIRDALGSRKQAVSHAPVRAGCVNFDYSRTRRCVGRRDLRPANTTSTWEPPVSSDDEASSQSKPLATQPPVLALSNAPPRRVSPTRGRRRHTRLRRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT-3 MAb (Clone 41512)
MAB267-500 500 µg

Human NT-3 MAb (Clone 41512)

Sign In for Pricing
View Details
NCKX2 shRNA (h) Lentiviral Particles
sc-72258-V 200 µL

NCKX2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
NARG2, NT (NARG2, BRCC1, NMDA receptor-regulated protein 2) (MaxLight 650)
MBS6323855-01 0.1 mL

NARG2, NT (NARG2, BRCC1, NMDA receptor-regulated protein 2) (MaxLight 650)

Sign In for Pricing
View Details
NARG2, NT (NARG2, BRCC1, NMDA receptor-regulated protein 2) (MaxLight 650)
MBS6323855-02 5x 0.1 mL

NARG2, NT (NARG2, BRCC1, NMDA receptor-regulated protein 2) (MaxLight 650)

Sign In for Pricing
View Details
UNC2881
S7325-1g 1 g

UNC2881

Sign In for Pricing
View Details
Rabbit Polyclonal IRAK4 Antibody [mFluor Violet 610 SE]
NBP2-99534MFV610 0.1 mL

Rabbit Polyclonal IRAK4 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details