Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Protein UL20 (UL20), partial

This Recombinant Human herpesvirus 2 Protein UL20 (UL20), partial spans the amino acid sequence from region 1-63aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P89443

Expression Region

1-63aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTMRDDVPLLDRELVDEAACGGEDGELPLDEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMC1 (2H12/4), Biotin conjugate, 0.1mg/mL
BNCB2178-500 1x 500 µL

DMC1 (2H12/4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lung Squamous Cell Carcinoma Cancer-Associated Fibroblasts (CAFs)
CAF07-S 1000000 Cells

Human Lung Squamous Cell Carcinoma Cancer-Associated Fibroblasts (CAFs)

Sign In for Pricing
View Details
FAM55C (NXPE3) (NM_001134456) Human Over-expression Lysate
LC427447 20 µg

FAM55C (NXPE3) (NM_001134456) Human Over-expression Lysate

Sign In for Pricing
View Details
RPGR (C-term) Rabbit Polyclonal Antibody
AP53704PU-N 400 µL

RPGR (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human L-FABP/FABP1 Protein (His Tag)
PKSH032414-01 10 µg

Recombinant Human L-FABP/FABP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human L-FABP/FABP1 Protein (His Tag)
PKSH032414-02 50 µg

Recombinant Human L-FABP/FABP1 Protein (His Tag)

Sign In for Pricing
View Details