Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Small capsomere-interacting protein (SCP)

This Recombinant Human herpesvirus 2 Small capsomere-interacting protein (SCP) spans the amino acid sequence from region 1-112aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P89458

Expression Region

1-112aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAPQFHRPSTITADNVRALGMRGLVLATNNAQFIMDNSYPHPHGTQGAVREFLRGQAAALTDLGVTHANNTFAPQPMFAGDAAAEWLRPSFGLKRTYSPFVVRDPKTPSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human Angiopoietin 1/ANGPT1 protein
ATGP1236-100 100 µg

Recombinant human Angiopoietin 1/ANGPT1 protein

Sign In for Pricing
View Details
Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB)
CSB-EP303206ENV-01 20 µg

Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB)
CSB-EP303206ENV-02 100 µg

Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB)
CSB-EP303206ENV-03 1 mg

Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) CYCB1-5 Polyclonal Antibody
MBS7189220 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) CYCB1-5 Polyclonal Antibody

Sign In for Pricing
View Details
HADH Protein Vector (Human) (pPM-C-HA)
PV082227 500 ng

HADH Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details