Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-associated protein tau (MAPT), partial

This Recombinant Human Microtubule-associated protein tau (MAPT), partial spans the amino acid sequence from region 561-685aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)

UniProt

P10636

Expression Region

561-685aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Bradykinin (BK) ELISA Kit
EIA05385Ch 1 Kit

Chicken Bradykinin (BK) ELISA Kit

Sign In for Pricing
View Details
DDX3Y Rabbit pAb (APR21361N)
APR21361N-01 50 µL

DDX3Y Rabbit pAb (APR21361N)

Sign In for Pricing
View Details
DDX3Y Rabbit pAb (APR21361N)
APR21361N-02 100 µL

DDX3Y Rabbit pAb (APR21361N)

Sign In for Pricing
View Details
DDX3Y Rabbit pAb (APR21361N)
APR21361N-03 200 µL

DDX3Y Rabbit pAb (APR21361N)

Sign In for Pricing
View Details
Olfr1366 Mouse qPCR Primer Pair (NM_146283)
MP209577 200 Reactions

Olfr1366 Mouse qPCR Primer Pair (NM_146283)

Sign In for Pricing
View Details
DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 19B (DDX19B) Antibody
abx325796-01 50 µg

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 19B (DDX19B) Antibody

Sign In for Pricing
View Details