Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus 1A Genome polyprotein, partial

This Recombinant Human rhinovirus 1A Genome polyprotein, partial spans the amino acid sequence from region 571-857aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VP4-VP2) (P1A) (Virion protein 4) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (P2A) (Picornain 2A) (Protein 2A) (P2B) (P2C) (P3A) (VPg) (Protein 3B) (P3B) (Picornain 3C) (P3C) (RdRp) (3D polymerase) (3Dpol) (Protein 3D) (3D)

UniProt

P23008

Expression Region

571-857aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human rhinovirus 1A (HRV-1A)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein FAM57A (FAM57A) ELISA Kit
MBS9933420-01 48 Well

Rat Protein FAM57A (FAM57A) ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM57A (FAM57A) ELISA Kit
MBS9933420-02 96 Well

Rat Protein FAM57A (FAM57A) ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM57A (FAM57A) ELISA Kit
MBS9933420-03 5x 96 Well

Rat Protein FAM57A (FAM57A) ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM57A (FAM57A) ELISA Kit
MBS9933420-04 10x 96 Well

Rat Protein FAM57A (FAM57A) ELISA Kit

Sign In for Pricing
View Details
Human IFN-alpha/beta R1 MAb (Clone 1056928)
MAB2451-100 100 µg

Human IFN-alpha/beta R1 MAb (Clone 1056928)

Sign In for Pricing
View Details
COX20P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV721756 1.0 µg DNA

COX20P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details