Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Small capsomere-interacting protein (SCP), Biotinylated

This Recombinant Epstein-Barr virus Small capsomere-interacting protein (SCP), Biotinylated spans the amino acid sequence from region 1-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P14348

Expression Region

1-176aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARRLPKPTLQGRLEADFPDSPLLPKFQELNQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS711630 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF568 conjugate, 0.1mg/mL
BNC681120-500 1x 500 µL

Ep-CAM / CD326 (EGP40/1120), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CGGBP1 (NM_001008390) Human Over-expression Lysate
LC423417 20 µg

CGGBP1 (NM_001008390) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS509651 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
SPATA16 (NM_031955) Human Recombinant Protein
TP760135 50 µg

SPATA16 (NM_031955) Human Recombinant Protein

Sign In for Pricing
View Details
Lipoprotein Lipase Antibody
KC-19460-01 50 μL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details