Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)

This Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3) spans the amino acid sequence from region 2-291aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BRCA1-A complex subunit BRCC36) (BRCA1/BRCA2-containing complex subunit 3) (BRCA1/BRCA2-containing complex subunit 36) (BRISC complex subunit BRCC36)

UniProt

P46737

Expression Region

2-291aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMEELSSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1206 Lentiviral Activation Particles (m2)
sc-434991-LAC-2 200 µL

Olfr1206 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal COX5A Antibody [DyLight 680]
NBP3-06072FR 0.1 mL

Rabbit Polyclonal COX5A Antibody [DyLight 680]

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit
MBS9331613-01 48 Well

Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit
MBS9331613-02 96 Well

Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit
MBS9331613-03 5x 96 Well

Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit
MBS9331613-04 10x 96 Well

Mouse Serine/threonine-protein kinase DCLK3, DCLK3 ELISA Kit

Sign In for Pricing
View Details