Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-25 (MMP25)

This Recombinant Human Matrix metalloproteinase-25 (MMP25) spans the amino acid sequence from region 108-539aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MMP-25) (Leukolysin) (Membrane-type matrix metalloproteinase 6) (MT-MMP 6) (MTMMP6) (Membrane-type-6 matrix metalloproteinase) (MT6-MMP) (MT6MMP)

UniProt

Q9NPA2

Expression Region

108-539aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SFRP5 Protein, N-His
YMJ02701 100 μg

Recombinant Mouse SFRP5 Protein, N-His

Sign In for Pricing
View Details
SAP30 (Sin3A-Associated Protein, 30kD) (FITC)
251425-FITC 100 µL

SAP30 (Sin3A-Associated Protein, 30kD) (FITC)

Sign In for Pricing
View Details
Human Sialic Acid Synthase (SAS) AssayLite™ Antibody (RPE Conjugate)
33030-05151 5x 30 µg

Human Sialic Acid Synthase (SAS) AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
Chicken Creatine kinase B-type (CKB) Elisa Kit
EK780020 96 Well

Chicken Creatine kinase B-type (CKB) Elisa Kit

Sign In for Pricing
View Details
KLF17 Polyclonal Antibody
E-AB-64813-01 60 µL

KLF17 Polyclonal Antibody

Sign In for Pricing
View Details
KLF17 Polyclonal Antibody
E-AB-64813-02 120 µL

KLF17 Polyclonal Antibody

Sign In for Pricing
View Details