Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trefoil factor 3 (Tff3)

This Recombinant Mouse Trefoil factor 3 (Tff3) spans the amino acid sequence from region 23-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Intestinal trefoil factor) (mITF)

UniProt

Q62395

Expression Region

23-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF I p110 (C-10) : m-IgG1 BP-HRP Bundle
sc-532850 1 Kit

TAF I p110 (C-10) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
HERPUD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
23210061 1.0 µg DNA

HERPUD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal RGS16 Antibody (OTI2C9) [Alexa Fluor 700]
NBP2-73884AF700 0.1 mL

Mouse Monoclonal RGS16 Antibody (OTI2C9) [Alexa Fluor 700]

Sign In for Pricing
View Details
KCNA5 Protein Lysate (Mouse) with C-HA Tag
25329034 100 µg

KCNA5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-TIE2/TEK Antibody Picoband® (PE Conjugate)
RP1036-PE 100 µg/Vial

Anti-TIE2/TEK Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250)
MBS6009350-01 0.1 mg

ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250)

Sign In for Pricing
View Details