Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trefoil factor 3 (Tff3)

This Recombinant Mouse Trefoil factor 3 (Tff3) spans the amino acid sequence from region 23-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Intestinal trefoil factor) (mITF)

UniProt

Q62395

Expression Region

23-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Succinyl- (Glu9, Ala11,15) -Endothelin-1 (8-21)
orb2694107-01 5 mg

Succinyl- (Glu9, Ala11,15) -Endothelin-1 (8-21)

Sign In for Pricing
View Details
Succinyl- (Glu9, Ala11,15) -Endothelin-1 (8-21)
orb2694107-02 10 mg

Succinyl- (Glu9, Ala11,15) -Endothelin-1 (8-21)

Sign In for Pricing
View Details
KANSL1 Protein Vector (Human) (pPM-C-HA)
25284021 500 ng

KANSL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rex1 (ZFP42) (NM_174900) Human Recombinant Protein
TP762344 50 µg

Rex1 (ZFP42) (NM_174900) Human Recombinant Protein

Sign In for Pricing
View Details
H. pylori Antibody / Helicobacter pylori
orb2636483-01 20 µg

H. pylori Antibody / Helicobacter pylori

Sign In for Pricing
View Details
H. pylori Antibody / Helicobacter pylori
orb2636483-02 100 µg

H. pylori Antibody / Helicobacter pylori

Sign In for Pricing
View Details