Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3)

This Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3) spans the amino acid sequence from region 26-310aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DNase gamma) (DNase I homolog protein DHP2) (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD)

UniProt

O55070

Expression Region

26-310aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jaceidin
HY-114535 1 Each

Jaceidin

Sign In for Pricing
View Details
PON3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2540966 100 µL

PON3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Human RANGRF qPCR Primer Pair
QH39197S 200 Tests

Human RANGRF qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans K01H12.1 Polyclonal Antibody
MBS7192046 Inquire

Rabbit anti-Caenorhabditis elegans K01H12.1 Polyclonal Antibody

Sign In for Pricing
View Details
ITGA1 Antibody
orb1288808 100 µL

ITGA1 Antibody

Sign In for Pricing
View Details
ZNF431 Rabbit Polyclonal Antibody (FITC)
orb2126763 100 µL

ZNF431 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details