Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 1 (UBC1)

This Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 1 (UBC1) spans the amino acid sequence from region 1-152aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(E2 ubiquitin-conjugating enzyme 1) (Ubiquitin carrier protein 1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (Ubiquitin-protein ligase 1)

UniProt

P25865

Expression Region

1-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Protein Biochemistry

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrc2 Mouse shRNA Lentiviral Particle (Locus ID 17534)
TL501368V 500 µL Each

Mrc2 Mouse shRNA Lentiviral Particle (Locus ID 17534)

Sign In for Pricing
View Details
Complement C2 Antibody
MBS5312014-01 0.1 mL

Complement C2 Antibody

Sign In for Pricing
View Details
Complement C2 Antibody
MBS5312014-02 5x 0.1 mL

Complement C2 Antibody

Sign In for Pricing
View Details
Rabbit Anti-HSP27 antibody
SL20666R-01 50 µL

Rabbit Anti-HSP27 antibody

Sign In for Pricing
View Details
Rabbit Anti-HSP27 antibody
SL20666R-02 100 µL

Rabbit Anti-HSP27 antibody

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Probable endonuclease 4 (nfo)
MBS1033788-01 0.02 mg (E-Coli)

Recombinant Citrobacter koseri Probable endonuclease 4 (nfo)

Sign In for Pricing
View Details