Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD9 antigen (CD9), partial, Biotinylated

This Recombinant Human CD9 antigen (CD9), partial, Biotinylated spans the amino acid sequence from region 112-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

UniProt

P21926

Expression Region

112-195aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blmh (NM_178645) Mouse Tagged ORF Clone Lentiviral Particle
MR207269L3V 200 µL

Blmh (NM_178645) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Cadherin-11 ELISA Kit
MBS2884118-01 48 Well

Mouse Cadherin-11 ELISA Kit

Sign In for Pricing
View Details
Mouse Cadherin-11 ELISA Kit
MBS2884118-02 96 Well

Mouse Cadherin-11 ELISA Kit

Sign In for Pricing
View Details
Mouse Cadherin-11 ELISA Kit
MBS2884118-03 5x 96 Well

Mouse Cadherin-11 ELISA Kit

Sign In for Pricing
View Details
Mouse Cadherin-11 ELISA Kit
MBS2884118-04 10x 96 Well

Mouse Cadherin-11 ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse KEAP1 Protein, His (Fc)-Avi-tagged
KEAP1-4789M 50 µg

Recombinant Mouse KEAP1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details