Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD9 antigen (CD9), partial, Biotinylated

This Recombinant Human CD9 antigen (CD9), partial, Biotinylated spans the amino acid sequence from region 112-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

UniProt

P21926

Expression Region

112-195aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4 Overexpression Lysate (Native) - (Dry Ice)
NBL1-11576 0.1 mg

Histone H4 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Gm44 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22031154 3x 1.0 µg DNA

Gm44 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Nodal Rabbit pAb, IRDye 800CW conjugated
orb2840521 100 µL

Nodal Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Acid-Sensing Ion Channel 1 (ASIC1) Antibody (ATTO 655)
abx441592 100 µg

Acid-Sensing Ion Channel 1 (ASIC1) Antibody (ATTO 655)

Sign In for Pricing
View Details
Rabbit Polyclonal VAChT/SLC18A3 Antibody
NBP3-35635-20ul 20 µL

Rabbit Polyclonal VAChT/SLC18A3 Antibody

Sign In for Pricing
View Details
DNAJC14 Protein Vector (Human) (pPM-C-HA)
18395023 500 ng

DNAJC14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details